CIRBP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125813
Article Name: CIRBP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125813
Supplier Catalog Number: orb2125813
Alternative Catalog Number: BYT-ORB2125813-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CIRBP
Conjugation: Biotin
Alternative Names: CIRP
CIRBP Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 19kDa
NCBI: 69522
UniProt: Q14011
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFG