BFSP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125822
Article Name: BFSP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125822
Supplier Catalog Number: orb2125822
Alternative Catalog Number: BYT-ORB2125822-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BFSP1
Conjugation: Biotin
Alternative Names: CP94, CP115, LIFL-H, CTRCT33
BFSP1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 74kDa
NCBI: 001186
UniProt: Q12934
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QVESNRQRVRDLEAERARLERQGTEAQRALDEFRSKYENECECQLLLKEM