PUM3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125843
Article Name: PUM3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125843
Supplier Catalog Number: orb2125843
Alternative Catalog Number: BYT-ORB2125843-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0020
Conjugation: Biotin
Alternative Names: PEN, HA-8, PUF6, XTP5, PUF-A, HLA-HA8, KIAA0020
PUM3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 71kDa
NCBI: 001026861
UniProt: Q15397
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PAHTVREIIEVLQKGDGNAHSKKDTEVRRRELLESISPALLSYLQEHAQE