CARS Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125912
Article Name: CARS Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125912
Supplier Catalog Number: orb2125912
Alternative Catalog Number: BYT-ORB2125912-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CARS
Conjugation: Biotin
Alternative Names: CARS, MDBH, CYSRS, MCDDBH, MGC:11246
CARS Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 81kDa
NCBI: 001014438
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MQTPPLQQPHQEQVFLAFLVIVIPSFLTKEVFIPQDGKKVTWYCCGPTVY