CARS Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125921
Article Name: CARS Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125921
Supplier Catalog Number: orb2125921
Alternative Catalog Number: BYT-ORB2125921-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CARS
Conjugation: Biotin
Alternative Names: CARS, MDBH, CYSRS, MCDDBH, MGC:11246
CARS Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 95kDa
UniProt: P49589
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ADSSGQQAPDYRSILSISDEAARAQALNEHLSTRSYVQGYSLSQADVDAF