ZNF791 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2126479
Article Name: ZNF791 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2126479
Supplier Catalog Number: orb2126479
Alternative Catalog Number: BYT-ORB2126479-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF791
Conjugation: Biotin
Alternative Names: FLJ90396, MGC126179, MGC126180
ZNF791 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 67kDa
NCBI: 699189
UniProt: Q3KP31
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ETFKNLASIGEKWEDPNVEDQHKNQGRNLRSHTGERLCEGKEGSQCAENF