ZFP28 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2127418
Article Name: ZFP28 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2127418
Supplier Catalog Number: orb2127418
Alternative Catalog Number: BYT-ORB2127418-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZFP28
Conjugation: Biotin
Alternative Names: mkr5
ZFP28 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 99kDa
NCBI: 065879
UniProt: Q8NHY6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RKTFIQIGHLNQHKRVHTGERSYNYKKSRKVFRQTAHLAHHQRIHTGESS