ZNF304 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2127442
Article Name: ZNF304 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2127442
Supplier Catalog Number: orb2127442
Alternative Catalog Number: BYT-ORB2127442-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF304
Conjugation: Biotin
Alternative Names: MGC129703, MGC129704
ZNF304 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 75kDa
NCBI: 065708
UniProt: Q9HCX3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MAAAVLMDRVQSCVTFEDVFVYFSREEWELLEEAQRFLYRDVMLENFALV