DMAP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2127535
Article Name: DMAP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2127535
Supplier Catalog Number: orb2127535
Alternative Catalog Number: BYT-ORB2127535-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DMAP1
Conjugation: Biotin
Alternative Names: EAF2, SWC4, MEAF2, DNMAP1, DNMTAP1
DMAP1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 53kDa
NCBI: 061973
UniProt: Q9NPF5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRP