HIF1AN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2127643
Article Name: HIF1AN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2127643
Supplier Catalog Number: orb2127643
Alternative Catalog Number: BYT-ORB2127643-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HIF1AN
Conjugation: Biotin
Alternative Names: FIH1
HIF1AN Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 060372
UniProt: Q9NWT6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDP