JMJD1B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2127721
| Article Name: |
JMJD1B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2127721 |
| Supplier Catalog Number: |
orb2127721 |
| Alternative Catalog Number: |
BYT-ORB2127721-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human JMJD1B |
| Conjugation: |
Biotin |
| Alternative Names: |
5qNCA, DIJOS, NET22, C5orf7, JMJD1B |
| JMJD1B Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
192kDa |
| NCBI: |
057688 |
| UniProt: |
Q7LBC6 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: VHNLYSCIKVAEDFVSPEHVKHCFRLTQEFRHLSNTHTNHEDKLQVKNII |
