ARID3B Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2128449
Article Name: ARID3B Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2128449
Supplier Catalog Number: orb2128449
Alternative Catalog Number: BYT-ORB2128449-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ARID3B
Conjugation: FITC
Alternative Names: BDP, DRIL2
ARID3B Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 006456
UniProt: O95443
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AQKPVVHLITGSAPQSLGSSASSSSSSHCSPSPTSSRGTPSAEPSTSWSL