PDLIM5 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2128454
Article Name: PDLIM5 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2128454
Supplier Catalog Number: orb2128454
Alternative Catalog Number: BYT-ORB2128454-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PDLIM5
Conjugation: HRP
Alternative Names: L9, ENH, LIM, ENH1
PDLIM5 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 006448
UniProt: Q5UW38
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: AGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF