PHOX2A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2128834
Article Name: PHOX2A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2128834
Supplier Catalog Number: orb2128834
Alternative Catalog Number: BYT-ORB2128834-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PHOX2A
Conjugation: Biotin
Alternative Names: ARIX, FEOM2, NCAM2, PMX2A, CFEOM2
PHOX2A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 005160
UniProt: O14813
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VAGGGGGGPGAGAAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF