SIM1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2128876
Article Name: SIM1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2128876
Supplier Catalog Number: orb2128876
Alternative Catalog Number: BYT-ORB2128876-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SIM1
Conjugation: Biotin
Alternative Names: bHLHe14
SIM1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 85kDa
NCBI: 005059
UniProt: P81133
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MKEKSKNAARTRREKENSEFYELAKLLPLPSAITSQLDKASIIRLTTSYL