NRF1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2128885
Article Name: NRF1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2128885
Supplier Catalog Number: orb2128885
Alternative Catalog Number: BYT-ORB2128885-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NRF1
Conjugation: Biotin
Alternative Names: ALPHA-PAL
NRF1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 56kDa
NCBI: 005002
UniProt: Q96AN2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IVLSGETAAAVGALTGVQDANGLFMADRAGRKWILTDKATGLVQIPVSMY