WDR39 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2128930
Article Name: WDR39 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2128930
Supplier Catalog Number: orb2128930
Alternative Catalog Number: BYT-ORB2128930-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human WDR39
Conjugation: Biotin
Alternative Names: CIA1, WDR39
WDR39 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 004795
UniProt: O76071
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: HSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQ