TCF15 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2128957
Article Name: TCF15 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2128957
Supplier Catalog Number: orb2128957
Alternative Catalog Number: BYT-ORB2128957-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TCF15
Conjugation: Biotin
Alternative Names: EC2, PARAXIS, bHLHa40
TCF15 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 004600
UniProt: Q12870
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGPEAARRG