EGR3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2129011
Article Name: EGR3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2129011
Supplier Catalog Number: orb2129011
Alternative Catalog Number: BYT-ORB2129011-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EGR3
Conjugation: Biotin
Alternative Names: EGR-3, PILOT
EGR3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 004421
UniProt: Q06889
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FCGRKFARSDERKRHAKIHLKQKEKKAEKGGAPSASSAPPVSLAPVVTTC