RCAN1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2129020
Article Name: RCAN1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2129020
Supplier Catalog Number: orb2129020
Alternative Catalog Number: BYT-ORB2129020-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RCAN1
Conjugation: Biotin
Alternative Names: CSP1, DSC1, RCN1, DSCR1, MCIP1, ADAPT78
RCAN1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 004405
UniProt: P53805
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEME