SAP30 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2129122
Article Name: SAP30 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2129122
Supplier Catalog Number: orb2129122
Alternative Catalog Number: BYT-ORB2129122-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SAP30
Conjugation: Biotin
SAP30 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 003855
UniProt: O75446
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYF