BLZF1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2129155
Article Name: BLZF1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2129155
Supplier Catalog Number: orb2129155
Alternative Catalog Number: BYT-ORB2129155-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human BLZF1
Conjugation: Biotin
Alternative Names: JEM1, JEM-1, JEM-1s, GOLGIN-45
BLZF1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 45kDa
NCBI: 003657
UniProt: Q9H2G9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DPVTCKESSPDNPFFESSPTTLLATKKNIGRFHPYTRYENITFNCCNHCR