ZNF8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2129224
Article Name: ZNF8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2129224
Supplier Catalog Number: orb2129224
Alternative Catalog Number: BYT-ORB2129224-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF8
Conjugation: Biotin
Alternative Names: HF.18, Zfp128
ZNF8 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 63kDa
NCBI: 066575
UniProt: P17098
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AVDFTQEEWGQLDPTQRILYRDVMLETFGHLLSIGPELPKPEVISQLEQG