E2f7 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Catalog Number:
BYT-ORB2130310
| Article Name: |
E2f7 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2130310 |
| Supplier Catalog Number: |
orb2130310 |
| Alternative Catalog Number: |
BYT-ORB2130310-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse E2f7 |
| Conjugation: |
FITC |
| Alternative Names: |
E2F-7, D10Ertd739, D10Ertd739e, A630014C11Rik |
| E2f7 Rabbit Polyclonal Antibody (FITC) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
99kDa |
| NCBI: |
848724 |
| UniProt: |
Q8BSQ3 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: MEVNCLTLKDLISPRQTRLDFAIEDAENAQKENIFVDRSRMTPKTPMKNE |
