Tmem130 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2130319
Article Name: Tmem130 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2130319
Supplier Catalog Number: orb2130319
Alternative Catalog Number: BYT-ORB2130319-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: FITC
Alternative Names: BC067004, C130036G08
Tmem130 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 808403
UniProt: Q6NXM3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FTVKVRVVAEWEQIKPDTTKGTIQKTGDFSASLDLRESLQGIQILGPTLL