Rbfox2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2130345
Article Name: Rbfox2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2130345
Supplier Catalog Number: orb2130345
Alternative Catalog Number: BYT-ORB2130345-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rbfox2
Conjugation: HRP
Alternative Names: Fxh, Rbm, Fbm2, Rbm9, Hrnbp2
Rbfox2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 001104297
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: PVPGAGADGPEPGLSKRPRTEEAADGGMQNEPLTPGYHGFPARDGQGNQE