Vgll2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Catalog Number:
BYT-ORB2130396
| Article Name: |
Vgll2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2130396 |
| Supplier Catalog Number: |
orb2130396 |
| Alternative Catalog Number: |
BYT-ORB2130396-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Conjugation: |
HRP |
| Alternative Names: |
Vi, VIT, Vgl, Vito1, vgl-2, VITO-1, C130057C21Rik |
| Vgll2 Rabbit Polyclonal Antibody (HRP) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
34kDa |
| NCBI: |
722481 |
| UniProt: |
Q8BGW8 |
| Buffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Form: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequence: |
Synthetic peptide located within the following region: APASAPAPGSPPCELAAKGEPAGSAWAAPGGPFVSPTGDVAQSLGLSVDS |
