Nr5a1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2130446
| Article Name: |
Nr5a1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2130446 |
| Supplier Catalog Number: |
orb2130446 |
| Alternative Catalog Number: |
BYT-ORB2130446-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Nr5a1 |
| Conjugation: |
Biotin |
| Alternative Names: |
E, SF, Ad4, ELP, SF-, SF1, SF-1, Ad4BP, ELP-3, Ftzf1, STF-1, Ftz-F1 |
| Nr5a1 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
52kDa |
| NCBI: |
620639 |
| UniProt: |
P33242 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: VADQMTLLQNCWSELLVLDHIYRQVQYGKEDSILLVTGQEVELSTVAVQA |
