Vsx1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2130494
Article Name: Vsx1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2130494
Supplier Catalog Number: orb2130494
Alternative Catalog Number: BYT-ORB2130494-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Vsx1
Conjugation: Biotin
Alternative Names: CHX10-li, CHX10-like
Vsx1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 473409
UniProt: Q91V10
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TGMRKPESEDKLAGLWEFDHLKKGANKDEDGPERGPDETTQNPENSLEDV