Ddx54 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2130566
Article Name: Ddx54 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2130566
Supplier Catalog Number: orb2130566
Alternative Catalog Number: BYT-ORB2130566-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: Biotin
Alternative Names: AP, DP9, DP97, AI414901, 2410015A15Rik
Ddx54 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 98kDa
NCBI: 082317
UniProt: Q8K4L0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ISSSYKRDLYQKWKQKQKIDDRDSEEEGPSNQRGPGPRRGGKRGRSQGTS