Tsc22d4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2130629
| Article Name: |
Tsc22d4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2130629 |
| Supplier Catalog Number: |
orb2130629 |
| Alternative Catalog Number: |
BYT-ORB2130629-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of mouse Tsc22d4 |
| Conjugation: |
Biotin |
| Alternative Names: |
Tilz2, Thg-1p, AI415410, Thg-1pit, 0610009M14Rik, 1700023B23Rik |
| Tsc22d4 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
40kDa |
| NCBI: |
076399 |
| UniProt: |
Q99PD5 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: VAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSML |
