PYCARD Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2130650
Article Name: PYCARD Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2130650
Supplier Catalog Number: orb2130650
Alternative Catalog Number: BYT-ORB2130650-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse PYCARD
Conjugation: Biotin
Alternative Names: A, Asc, TMS-, TNS1, masc, CARD5, TMS-1, 9130417A21Rik
PYCARD Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 075747
UniProt: Q9EPB4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TVLRDMGLQELAEQLQTTKEESGAVAAAASVPAQSTARTGHFVDQHRQAL