Nrip2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2130665
Article Name: Nrip2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2130665
Supplier Catalog Number: orb2130665
Alternative Catalog Number: BYT-ORB2130665-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse Nrip2
Conjugation: Biotin
Alternative Names: NI, NIX1, AW491344
Nrip2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 068363
UniProt: Q9JHR9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MSTGQEARRDEGDSRKEQEASLRDRAHLSQQRQLKQATQFLHKDSADLLP