Mybbp1a Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2130752
| Article Name: |
Mybbp1a Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2130752 |
| Supplier Catalog Number: |
orb2130752 |
| Alternative Catalog Number: |
BYT-ORB2130752-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of mouse Mybbp1a |
| Conjugation: |
Biotin |
| Alternative Names: |
P160, p67M, p160M, p67MBP, p160MBP, AL024407, AU019902 |
| Mybbp1a Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
152kDa |
| NCBI: |
058056 |
| UniProt: |
O35821 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: EKKNAKDIPSDTQSPVSTKRKKKGFLPETKKRKKLKSEGTTPEKNAASQQ |
