Snai3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2130785
Article Name: Snai3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2130785
Supplier Catalog Number: orb2130785
Alternative Catalog Number: BYT-ORB2130785-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of mouse Snai3
Conjugation: Biotin
Alternative Names: Smu, Smuc, Zfp29, Zfp293, AI643946
Snai3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 038942
UniProt: Q9QY31
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MPRSFLVKTHSSHRVPNYGKLETLREANGSCSACKELAGSRHLPDEEAPC