CCL5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2130800
Article Name: CCL5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2130800
Supplier Catalog Number: orb2130800
Alternative Catalog Number: BYT-ORB2130800-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse CCL5
Conjugation: Biotin
Alternative Names: S, RA, Scy, MuRa, SISd, Scya5, TCP22, RANTES, TCP228, MuRantes
CCL5 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 10kDa
NCBI: 038681
UniProt: P30882
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN