Tbx5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2130848
Article Name: Tbx5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2130848
Supplier Catalog Number: orb2130848
Alternative Catalog Number: BYT-ORB2130848-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Tbx5
Conjugation: Biotin
Tbx5 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 035667
UniProt: P70326
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TDEGFGLARTPLEPDSKDRSCDSKPESALGAPSKSPSSPQAAFTQQGMEG