SREBF1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2130857
Article Name: SREBF1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2130857
Supplier Catalog Number: orb2130857
Alternative Catalog Number: BYT-ORB2130857-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse SREBF1
Conjugation: Biotin
Alternative Names: SRE, ADD-, ADD1, SREB, SREBP, bHLHd, SREBP1, bHLHd1
SREBF1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 125kDa
NCBI: 035610
UniProt: Q9WTN3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASL