Sfpi1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2130866
| Article Name: |
Sfpi1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2130866 |
| Supplier Catalog Number: |
orb2130866 |
| Alternative Catalog Number: |
BYT-ORB2130866-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Sfpi1 |
| Conjugation: |
Biotin |
| Alternative Names: |
Sf, Sp, Dis, PU., Sfp, Dis1, PU.1, Dis-1, Sfpi1, Spi-1, Tcfpu, Tfpu., Sfpi-1, Tcfpu1, Tfpu.1 |
| Sfpi1 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
31kDa |
| NCBI: |
035485 |
| UniProt: |
P17433 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: MLQACKMEGFSLTAPPSDDLVTYDSELYQRPMHDYYSFVGSDGESHSDHY |
