Tcea2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2131061
| Article Name: |
Tcea2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2131061 |
| Supplier Catalog Number: |
orb2131061 |
| Alternative Catalog Number: |
BYT-ORB2131061-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of mouse Tcea2 |
| Conjugation: |
Biotin |
| Alternative Names: |
SII, S-II, Tcea, Tceat, SII-T1, S-II-T1, AI326274 |
| Tcea2 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
34 |
| NCBI: |
033352 |
| UniProt: |
Q9QVN7 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: KDASRTTDLSCKKPDPPRTPSTPRITTFPQVPITCDAVRNKCREMLTLAL |
