Irf1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131181
Article Name: Irf1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131181
Supplier Catalog Number: orb2131181
Alternative Catalog Number: BYT-ORB2131181-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: Biotin
Alternative Names: Irf, Irf-1, AU020929
Irf1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 032416
UniProt: P15314
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DIIPDSTTDLYNLQVSPMPSTSEAATDEDEEGKIAEDLMKLFEQSEWQPT