ARNTL Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131313
Article Name: ARNTL Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131313
Supplier Catalog Number: orb2131313
Alternative Catalog Number: BYT-ORB2131313-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse ARNTL
Conjugation: Biotin
Alternative Names: Ar, MO, Bma, MOP3, Arnt3, Bmal1, bHLHe, BMAL1b, bHLHe5, bmal1b
ARNTL Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 26kDa
NCBI: 00990
UniProt: Q68HB9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SGVDCNRKRKGSATDYQLDDFAFEESMDTDKDDPHGRLEYAEHQGRIKNA