KCNRG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131385
Article Name: KCNRG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131385
Supplier Catalog Number: orb2131385
Alternative Catalog Number: BYT-ORB2131385-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCNRG
Conjugation: Biotin
Alternative Names: DLTET
KCNRG Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 775876
UniProt: Q8N5I3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIF