CX36 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131457
Article Name: CX36 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131457
Supplier Catalog Number: orb2131457
Alternative Catalog Number: BYT-ORB2131457-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CX36
Conjugation: Biotin
Alternative Names: CX36, GJA9
CX36 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 065711
UniProt: Q9UKL4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNA