Mycbp Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131595
Article Name: Mycbp Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131595
Supplier Catalog Number: orb2131595
Alternative Catalog Number: BYT-ORB2131595-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Mycbp
Conjugation: Biotin
Alternative Names: Amy-, Amy-1, AW552132, AW742590, 5730488M09Rik
Mycbp Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 12kDa
NCBI: 062634
UniProt: Q9EQS3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: HLGAATPENPEIELLRLELAEMKEKYEATVEENKKLKAKLVQYEPPQEEK