GJA1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131625
Article Name: GJA1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131625
Supplier Catalog Number: orb2131625
Alternative Catalog Number: BYT-ORB2131625-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GJA1
Conjugation: Biotin
Alternative Names: HSS, CMDR, CX43, EKVP, GJAL, ODDD, AVSD3, EKVP3, HLHS1, PPKCA
GJA1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 000156
UniProt: Q53FJ6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIE