INTS6L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131724
Article Name: INTS6L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131724
Supplier Catalog Number: orb2131724
Alternative Catalog Number: BYT-ORB2131724-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DDX26B
Conjugation: Biotin
Alternative Names: DDX26B
INTS6L Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 97kDa
NCBI: 872346
UniProt: Q5JSJ4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ASTEPEQLGSVPTDESAITQMCEVTGGRSYCVRTQRMLNQCLESLVQKVQ