DDX51 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131727
Article Name: DDX51 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131727
Supplier Catalog Number: orb2131727
Alternative Catalog Number: BYT-ORB2131727-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DDX51
Conjugation: Biotin
Alternative Names: DKFZp686N2081, MGC42193
DDX51 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 72kDa
NCBI: 778236
UniProt: Q8N8A6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FNIYTDATPLRVSLVTGQKSLAKEQESLVQKTADGYRCLADIVVATPGRL