HELB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131754
Article Name: HELB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131754
Supplier Catalog Number: orb2131754
Alternative Catalog Number: BYT-ORB2131754-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HELB
Conjugation: Biotin
Alternative Names: DHB, hDHB
HELB Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 120kDa
NCBI: 387467
UniProt: Q8NG08
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FGRFPITGAWWRVKVQVKPVVGSRSYQYQVQGFPSYFLQSDMSPPNQKHI