DDX50 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2131769
Article Name: DDX50 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2131769
Supplier Catalog Number: orb2131769
Alternative Catalog Number: BYT-ORB2131769-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DDX50
Conjugation: Biotin
Alternative Names: GU2, GUB, mcdrh, RH-II/GuB
DDX50 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 81kDa
NCBI: 076950
UniProt: Q9BQ39
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPKAKKSKMK